PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587939.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 226aa    MW: 26323.7 Da    PI: 8.8503
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587939.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.62.8e-2067119456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + ++t++qle Le+ F+++ +++ e++ +LAk+lgL+ rq+ vWFqNrRa++k
  XP_009587939.1  67 KKRLTSDQLESLENSFQEEIKLDPERKIKLAKELGLQPRQIAVWFQNRRARWK 119
                     5679************************************************9 PP

2HD-ZIP_I/II119.71.6e-3866157293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     kk+rl+++q+++LE+sF+ee kL+perK +la+eLglqprq+avWFqnrRAR+k+kqlE+ y++Lk+ yd +++e+++L++ev +Lr+ lke
  XP_009587939.1  66 KKKRLTSDQLESLENSFQEEIKLDPERKIKLAKELGLQPRQIAVWFQNRRARWKSKQLERLYDSLKQDYDLVSREKQKLQNEVLALRAILKE 157
                     9**************************************************************************************88875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.27E-1952123IPR009057Homeodomain-like
PROSITE profilePS5007117.49161121IPR001356Homeobox domain
SMARTSM003895.3E-1863125IPR001356Homeobox domain
PfamPF000461.1E-1766119IPR001356Homeobox domain
CDDcd000866.28E-1766122No hitNo description
Gene3DG3DSA:1.10.10.601.4E-2168128IPR009057Homeodomain-like
PRINTSPR000319.7E-692101IPR000047Helix-turn-helix motif
PROSITE patternPS00027096119IPR017970Homeobox, conserved site
PRINTSPR000319.7E-6101117IPR000047Helix-turn-helix motif
PfamPF021834.5E-7121155IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0010434Biological Processbract formation
GO:0010582Biological Processfloral meristem determinacy
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MDWNGNLRSF VSRPAPPDNS FNFLYSYNYD QYPGMEMKHA MQTPHSGVLP TMDKLNDNFA  60
MNQLDKKKRL TSDQLESLEN SFQEEIKLDP ERKIKLAKEL GLQPRQIAVW FQNRRARWKS  120
KQLERLYDSL KQDYDLVSRE KQKLQNEVLA LRAILKEQAT KKQVNSTVYT EISGEETVES  180
TSMPSSNKTR GISTSNHQNN NMAECSYVFN VNNVEGFNPV MPPYWV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1113121RRARWKSKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00486DAPTransfer from AT5G03790Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754486e-53HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587939.11e-170PREDICTED: putative homeobox-leucine zipper protein ATHB-51
RefseqXP_016444539.11e-170PREDICTED: putative homeobox-leucine zipper protein ATHB-51
SwissprotQ9LZR03e-57ATB51_ARATH; Putative homeobox-leucine zipper protein ATHB-51
TrEMBLK4CQR61e-129K4CQR6_SOLLC; Uncharacterized protein
STRINGSolyc09g008810.2.11e-129(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA38692246
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03790.12e-58homeobox 51